PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029747-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 715aa    MW: 79163.3 Da    PI: 7.3161
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029747-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR150.47.4e-164935651186
                   FAR1  11 GFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                             Fs+rk+  +ksk +g +++r+++C ++g+ +++++    + ++r+etrtgC+a+++++++++gk++v+++e+ Hn
  SMil_00029747-RA_Salv 493 SFSIRKDFVNKSKVTGLVVSRRYTCHRQGYGSSKRDM---NMKPRKETRTGCQAHMTITRQTNGKYRVIHFETRHN 565
                            5******************************998776...999********************************9 PP

2FAR188.87.9e-28591680191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA ++GFs+rk++ ++sk +g + +r+++C +eg+r+++k+  +k +r+r+etr+gC a+l+++++ dg+++vt++e+ HnHe
  SMil_00029747-RA_Salv 591 EFYNAYAGRLGFSIRKDYVNRSKVDGAVASRRYTCFREGYRQNDKRG-SKVKRPRKETRVGCMAQLVISRQADGRYRVTHFEERHNHE 677
                            6*******************************************999.99************************************** PP

                   FAR1  89 lap 91 
                            l+p
  SMil_00029747-RA_Salv 678 LVP 680
                            *86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-13494565IPR004330FAR1 DNA binding domain
PfamPF031017.9E-25591680IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MESAEEYIAD LRQFGEEENS AIGVEEVMCN ACFHQVESAN HWFLTCPKAY THAQIFFTFG  60
DCEVAAVVFL LNSRGRRRKP PPSLRLSLSP SLLLSLVLST IHAIALNPPL PIPLFRTCRC  120
CYESGERPTP RRVSFAENRH AAAPSPSPSL FCWALLDPDS SHDRCQAHNS DATDAPLPLI  180
LRTDSTSEES RTAAASGDCR YARSYGKTGQ QQGATPTAAS LHARRDQSNG TGLYHPRLPT  240
RQVSTAYTSS KFNLCYKIVW VCLCKGVVLE AWRYVREGVE IVGIIFSYVN ADCFKQSIDK  300
IIHRDFVPIV SSIDFAAQSV SWSMDSGLGS GARDSSEDDI VGVGDPTAVV DACINQIGEV  360
SSFLYDDEEV FVHEDASLSR EASSTEKDGM DVDRESTYSC LNSSSSEEKS FDSDGKHESA  420
SQNGCLNNDA ECKSPKACIS GNNGPDILGE QDDRSPGISS DDQLGMDADD KQVSIAETPS  480
NASSGSIKDE LKSFSIRKDF VNKSKVTGLV VSRRYTCHRQ GYGSSKRDMN MKPRKETRTG  540
CQAHMTITRQ TNGKYRVIHF ETRHNRMDCC SGARWGPKAG DGVDSEDHAY EFYNAYAGRL  600
GFSIRKDYVN RSKVDGAVAS RRYTCFREGY RQNDKRGSKV KRPRKETRVG CMAQLVISRQ  660
ADGRYRVTHF EERHNHELVP ACKVRTLRSQ RRSLTNQIVE PSASGASDMP PKSVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098802.11e-166PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098803.11e-166PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098804.11e-166PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098805.11e-167PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.23e-22FAR1 family protein